Return to main results Retrieve Phyre Job Id

Job DescriptionP0A0J0
Confidence61.53%DateTue Jul 17 17:05:06 BST 2012
Rank300Aligned Residues39
% Identity31%Templatec3f2hA_
PDB info PDB header:lyaseChain: A: PDB Molecule:alkylmercury lyase; PDBTitle: crystal structure of the mercury-bound form of merb mutant2 c160s, the organomercurial lyase involved in a bacterial3 mercury resistance system
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220.........230.........240.........250.....
Predicted Secondary structure 















Query SS confidence 



































































Query Sequence  TWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLPAEKVREILK
Query Conservation     

  
   
      

 
                     

 
   


  
      
     
Alig confidence 













.............................
























Template Conservation         


 

 .............................
 

    

         
   
 
Template Sequence  TADLLVPLLRELAK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRPVSRTTLAGILDWPAERVAAVLE
Template Known Secondary structure  TT.............................SS
B
T

Template Predicted Secondary structure 

.............................







Template SS confidence 



































































   20.........30... ......40.........50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions