Return to main results Retrieve Phyre Job Id

Job DescriptionP47768
Confidence20.00%DateTue Jul 17 17:05:10 BST 2012
Rank28Aligned Residues19
% Identity47%Templated1y4oa1
SCOP infoProfilin-like Roadblock/LC7 domain Roadblock/LC7 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   930.........940.........950.........960.....
Predicted Secondary structure 






















Query SS confidence 



































Query Sequence  GNKGVISKIVPEEDMPYLPDGRPIDIMLNPLGVPSR
Query Conservation 




 
 
   





  
  












Alig confidence 








.................









Template Conservation    


 
 
.................


  
 


Template Sequence  SQKGVQGII. . . . . . . . . . . . . . . . . VVNTEGIPIK
Template Known Secondary structure  STT.................TTT
Template Predicted Secondary structure 



.................




Template SS confidence 



































   21........ 30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions