Return to main results Retrieve Phyre Job Id

Job DescriptionP47768
Confidence11.59%DateTue Jul 17 17:05:10 BST 2012
Rank56Aligned Residues21
% Identity33%Templatec1gjjA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:lap2; PDBTitle: n-terminal constant region of the nuclear envelope protein2 lap2
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   944. ....950.........960.........970.......
Predicted Secondary structure 

.














Query SS confidence 

.































Query Sequence  MP. YLPDGRPIDIMLNPLGVPSRMNIGQVLELHLG
Query Conservation 

.

  
  
















 


   
Alig confidence 

.



.............














Template Conservation 
     
.............

 


  


 
 
Template Sequence  MPEFLED. . . . . . . . . . . . . PSVLTKDKLKSELVA
Template Known Secondary structure 




S
.............B
Template Predicted Secondary structure 



.............
Template SS confidence 


































   1...... ..10.........20..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions