Return to main results Retrieve Phyre Job Id

Job DescriptionO06446
Confidence29.72%DateTue Jul 17 17:05:02 BST 2012
Rank363Aligned Residues24
% Identity42%Templatec3t5dC_
PDB info PDB header:signaling proteinChain: C: PDB Molecule:septin-7; PDBTitle: crystal structure of septin 7 in complex with gdp
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   107..110.........120.........130......
Predicted Secondary structure 











Query SS confidence 





























Query Sequence  RTGEGKTLTATMPTYLNALAGRGVHVITVN
Query Conservation   







  


 
 

 
  




 
Alig confidence 







......















Template Conservation    
 



......




 
         
Template Sequence  ESGLGKST. . . . . . LINSLFLTDLIKKTVQ
Template Known Secondary structure 
TTSS......SSS



S


Template Predicted Secondary structure 




......









Template SS confidence 





























   3940...... ...50.........60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions