Return to main results Retrieve Phyre Job Id

Job DescriptionP52078
Confidence3.65%DateTue Jul 17 17:05:11 BST 2012
Rank75Aligned Residues24
% Identity33%Templatec1w8xN_
PDB info PDB header:virusChain: N: PDB Molecule:protein p31; PDBTitle: structural analysis of prd1
Resolution4.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   164.....170.........180.........190.....
Predicted Secondary structure 



















Query SS confidence 































Query Sequence  NELGGIYYDVPYDLNEPNTDDTGKIKIKKGYQ
Query Conservation 





 
 
                
  
 
Alig confidence 












........










Template Conservation     
   
    
........



   

 
Template Sequence  ENDGAFEIDVEET. . . . . . . . GQRIKCPAGKQ
Template Known Secondary structure 

TTS


........SS






Template Predicted Secondary structure 






........







Template SS confidence 































   64.....70...... ...80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions