Return to main results Retrieve Phyre Job Id

Job DescriptionO08387
Confidence4.20%DateTue Jul 17 17:05:02 BST 2012
Rank59Aligned Residues38
% Identity26%Templated1v54i_
SCOP infoSingle transmembrane helix Mitochondrial cytochrome c oxidase subunit VIc Mitochondrial cytochrome c oxidase subunit VIc
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   308.310.........320.........330...... ...340.....
Predicted Secondary structure 


..............



Query SS confidence 




























. . . . . . . . . . . . . .








Query Sequence  NVGMVVYIVLIILFTYFYAFVQVNPEKMA. . . . . . . . . . . . . . DNLKKQGSY
Query Conservation        
  


 
  
 
 
   
  

..............  
 
 
  
Alig confidence 




























..............








Template Conservation 
        

       
  
   













 











Template Sequence  RFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIF
Template Known Secondary structure  TT

TT

Template Predicted Secondary structure 


Template SS confidence 



















































   18.20.........30.........40.........50.........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions