Return to main results Retrieve Phyre Job Id

Job DescriptionO34090
Confidence22.57%DateTue Jul 17 17:05:02 BST 2012
Rank77Aligned Residues58
% Identity21%Templatec3onmB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator lrha; PDBTitle: effector binding domain of lysr-type transcription factor rovm from y.2 pseudotuberculosis
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70.........80..
Predicted Secondary structure 





























Query SS confidence 















































































Query Sequence  KLVVGSRRSKLALTQSQQFIDKLKAVEPNLEIEIKEIVTKGDRIVDKQLSKVGGKGLFVKEIQHELFEKNIDMAIHSLKD
Query Conservation   





 
 


 

  
   
    
    

  
 
 

      
  











 


 
 









Alig confidence 



















.






.








....................





















Template Conservation 




         

  
 . 
    
.
 
 
    ....................             
        
Template Sequence  SLIIGASDDTADTLLPFLLN. RVATLYP. LAIDVRVKR. . . . . . . . . . . . . . . . . . . . SPFIADMLSSGEVDLAITTAKV
Template Known Secondary structure 

TTT.TTS

.



....................GGGTTS
SSS

Template Predicted Secondary structure 
.

.
....................



















Template SS confidence 















































































   100.........110......... 120...... ...130..... ....140.........150.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions