Return to main results Retrieve Phyre Job Id

Job DescriptionP60643
Confidence2.34%DateTue Jul 17 17:05:12 BST 2012
Rank32Aligned Residues40
% Identity8%Templatec2k9pA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:pheromone alpha factor receptor; PDBTitle: structure of tm1_tm2 in lppg micelles
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.........70....
Predicted Secondary structure 







Query SS confidence 




















































Query Sequence  FLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKTYKIGGDIIYFFLEP
Query Conservation       
  
     
  
 
 
   

  
    
 
  
  
   
  



Alig confidence 















..












...........










Template Conservation 








 





..
 

 

 
 


...........




 



 
Template Sequence  LIVVWITSRSRKTPIF. . IINQVSLFLIILH. . . . . . . . . . . SALYFKYLLSN
Template Known Secondary structure  T

S


.............
Template Predicted Secondary structure 






.............

Template SS confidence 




















































   66...70.........80. ........90.... .....100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions