Return to main results Retrieve Phyre Job Id

Job DescriptionP60643
Confidence4.76%DateTue Jul 17 17:05:12 BST 2012
Rank14Aligned Residues61
% Identity20%Templatec2i88A_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:colicin-e1; PDBTitle: crystal structure of the channel-forming domain of colicin2 e1
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93...... 100.........110.........120.........130.........140.........150.........160.........
Predicted Secondary structure  ...





Query SS confidence 






. . .





































































Query Sequence  HWHRIIG. . . GIGIGTVVALLIILTFAKLAQFANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGN
Query Conservation      

 ...    
          
   

       

 









 

  


  



  





 

  
 
Alig confidence 






...















.................




.......
























Template Conservation 

 

 
  


 

  

   
  
.................
  
 .......  


 
 
 
 
 
 
 

     
Template Sequence  DWKPLFLTLEKKAADAGVSYVVALLF. . . . . . . . . . . . . . . . . SLLAG. . . . . . . TTLGIWGIAIVTGILCSYIDKNKLN
Template Known Secondary structure 

GGGT.................T.......



SS


Template Predicted Secondary structure 


........................
Template SS confidence 















































































   459460.........470.........480.... ..... 490.........500.........510....
 
   170.......
Predicted Secondary structure 

Query SS confidence 







Query Sequence  KFLKLFRI
Query Conservation   


   
Alig confidence 







Template Conservation   

  


Template Sequence  TINEVLGI
Template Known Secondary structure  T
Template Predicted Secondary structure 

Template SS confidence 







   515....520..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions