Return to main results Retrieve Phyre Job Id

Job DescriptionP0A0B9
Confidence29.84%DateTue Jul 17 17:05:05 BST 2012
Rank84Aligned Residues28
% Identity39%Templatec2e5vA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:l-aspartate oxidase; PDBTitle: crystal structure of l-aspartate oxidase from2 hyperthermophilic archaeon sulfolobus tokodaii
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50......
Predicted Secondary structure 


















Query SS confidence 























































Query Sequence  MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLAS
Query Conservation 
   
  
  

                       

   


  
  

     
Alig confidence 






............................




















Template Conservation   





............................
 


 

  

  
  
 

Template Sequence  MIYIIGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIAGLSAGVALRRAGKKVTLI
Template Known Secondary structure 


............................STT

Template Predicted Secondary structure 


............................




Template SS confidence 























































   1...... ..10.........20........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions