Return to main results Retrieve Phyre Job Id

Job DescriptionQ9CQP2
Confidence4.06%DateWed Jul 10 14:24:44 BST 2013
Rank54Aligned Residues26
% Identity19%Templatec4h61A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:mediator of rna polymerase ii transcription subunit 6; PDBTitle: structure of the schizosaccharomyces pombe mediator subunit med6
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   107..110. ........ 120.........130..
Predicted Secondary structure  .







............

Query SS confidence 




.







. . . . . . . . . . . .












Query Sequence  IKFAM. NPFYEPNS. . . . . . . . . . . . PIRSSAFDRKVQF
Query Conservation 
  
 .



    ............ 
 
  
   
  
Alig confidence 




.







............












Template Conservation 
 

  




  








           
  
  
Template Sequence  LEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKR
Template Known Secondary structure  TSTT

TTSTT




T
Template Predicted Secondary structure 















Template SS confidence 






































   34.....40.........50.........60.........70..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D