Return to main results Retrieve Phyre Job Id

Job DescriptionP59048
Confidence3.97%DateWed Jul 10 14:04:54 BST 2013
Rank100Aligned Residues40
% Identity10%Templatec1yuzB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nigerythrin; PDBTitle: partially reduced state of nigerythrin
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 









Query SS confidence 

























































Query Sequence  SPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSEDVMVC
Query Conservation 
    
    
 


  

 

  
  

 





 





 
 
      
 

 
Alig confidence 





















................








..








Template Conservation      
  
  

  
  
    ................   
  
  ..        
Template Sequence  NSKAVHVFTRAKLAESVHAERY. . . . . . . . . . . . . . . . LAAYNDIDA. . PDDDKFHLC
Template Known Secondary structure 
................TTT
..

S


Template Predicted Secondary structure 
................
..



Template SS confidence 

























































   135....140.........150...... ...160..... ....170....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D