Return to main results Retrieve Phyre Job Id

Job DescriptionO08908
Confidence34.16%DateWed Jul 10 14:15:46 BST 2013
Rank396Aligned Residues42
% Identity33%Templatec3ka5A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:ribosome-associated protein y (psrp-1); PDBTitle: crystal structure of ribosome-associated protein y (psrp-1)2 from clostridium acetobutylicum. northeast structural3 genomics consortium target id car123a
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   329330.........340.........350.........360.........370.... .....380......
Predicted Secondary structure 





















..




Query SS confidence 













































. .











Query Sequence  ISREEVNERLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKV. . FHRDGHYGFSEP
Query Conservation 





   
   











   
 




   
  

 

..   

  
    
Alig confidence 


























................


..











Template Conservation 






 



  
 
 

 
  
  ................






 

 





Template Sequence  XSEEEAVLEXELLGHNFFVFQNGDSNE. . . . . . . . . . . . . . . . VNVVYKRKDGNYGLIEP
Template Known Secondary structure  B
T
STTTT................
TTS


Template Predicted Secondary structure 










................




Template SS confidence 



























































   13......20.........30......... 40.........50......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D