Return to main results Retrieve Phyre Job Id

Job DescriptionA2A432
Confidence28.94%DateTue Jul 30 13:09:03 BST 2013
Rank194Aligned Residues37
% Identity22%Templated1mw9x_
SCOP infoProkaryotic type I DNA topoisomerase Prokaryotic type I DNA topoisomerase Prokaryotic type I DNA topoisomerase
Resolution1.67

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   908.910.........920.........930.........940.........950.........960.
Predicted Secondary structure 
















Query SS confidence 





















































Query Sequence  DAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKE
Query Conservation   







  
 
    
  

   
 
      

  

 






 

  
Alig confidence 











.................
























Template Conservation 
  

  

  
.................


 



 

  
  
 

     
Template Sequence  EASLVKELEKRG. . . . . . . . . . . . . . . . . IGRPSTYASIISTIQDRGYVRVENR
Template Known Secondary structure  TT.................


TTTTTSTT
Template Predicted Secondary structure 

.................










Template SS confidence 





















































   479480.........490 .........500.........510.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D