Return to main results Retrieve Phyre Job Id

Job DescriptionQ5F267
Confidence10.82%DateWed Jul 10 14:18:19 BST 2013
Rank22Aligned Residues28
% Identity32%Templated2h80a1
SCOP infoSAM domain-like SAM/Pointed domain Variant SAM domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   119120.........130.........140.........150......
Predicted Secondary structure 




















Query SS confidence 





































Query Sequence  WIEPAWVAHWLKRQRRRKQRKSVWFLSDNLFGPTPTMP
Query Conservation   
    
  


 
          
    
 


    
Alig confidence 











..........















Template Conservation 



 


 


..........








 


 

Template Sequence  EIEAKEACDWLR. . . . . . . . . . AAGFPQYAQLYEDSQF
Template Known Secondary structure  ..........TT
TTTTT

Template Predicted Secondary structure  ..........





Template SS confidence 





































   18.20......... 30.........40.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D