Return to main results Retrieve Phyre Job Id

Job DescriptionA2A3V1
Confidence93.80%DateTue Jul 30 13:01:13 BST 2013
Rank128Aligned Residues51
% Identity25%Templatec2adbA_
PDB info PDB header:rna binding protein/rnaChain: A: PDB Molecule:polypyrimidine tract-binding protein 1; PDBTitle: solution structure of polypyrimidine tract binding protein2 rbd2 complexed with cucucu rna
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   168.170.........180.........190.........200.........210.........220.......
Predicted Secondary structure 
























Query SS confidence 



























































Query Sequence  CEEILRVVFESFGKIKNVDIPMLDPYREVMTGGSFGGLNFGLQTFEAFIQYQESTDFIKA
Query Conservation                                                              
Alig confidence 




















..................




















Template Conservation 
 
 
   
   
 
  
 
 ..................       


 
     
  
Template Sequence  TLDVLHQIFSKFGTVLKIITF. . . . . . . . . . . . . . . . . . TKNNQFQALLQYADPVSAQHA
Template Known Secondary structure  TTTS
..................TTS
Template Predicted Secondary structure 





..................







Template SS confidence 



























































   196...200.........210...... ...220.........230.......
 
   228.230......
Predicted Secondary structure 


Query SS confidence 








Query Sequence  MESLRGMKL
Query Conservation           
Alig confidence 








Template Conservation     
 
  
Template Sequence  KLSLDGQNI
Template Known Secondary structure  S

S
Template Predicted Secondary structure 


Template SS confidence 








   238.240......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D