Return to main results Retrieve Phyre Job Id

Job DescriptionP02340
Confidence8.23%DateTue Jul 30 12:57:01 BST 2013
Rank53Aligned Residues31
% Identity29%Templatec2dfwA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:salt-tolerant glutaminase; PDBTitle: crystal structure of a major fragment of the salt-tolerant2 glutaminase from micrococcus luteus k-3
Resolution2.44 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100....... ..110... ......120......
Predicted Secondary structure 






.





.........



Query SS confidence 











.





. . . . . . . . .












Query Sequence  TYQGNYGFHLGF. LQSGTA. . . . . . . . . KSVMCTYSPPLNK
Query Conservation   


 
 
 
 
.      .........

  



  


Alig confidence 











.





.........












Template Conservation 
 

 

  


















  






 

 
Template Sequence  DAAGQWLADVGIPAKSGVAGGVLGALPGRVGIGVFSPRLDE
Template Known Secondary structure  TTT



TTSTTT


B
T
Template Predicted Secondary structure 














Template SS confidence 








































   244.....250.........260.........270.........280....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D