Return to main results Retrieve Phyre Job Id

Job DescriptionQ9DB75
Confidence46.49%DateTue Jul 30 13:11:58 BST 2013
Rank8Aligned Residues25
% Identity20%Templatec4a17Y_
PDB info PDB header:ribosomeChain: Y: PDB Molecule:rpl37a; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 2.
Resolution3.52 Å
Model Dimensions (Å)X:25.684 Y:30.321 Z:22.666

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200 ..... ...
Predicted Secondary structure 








.......

Query SS confidence 
















. . . . . .




.


Query Sequence  INDFKDVTHTCPSCKAY. . . . . . ICTYK. RLC
Query Conservation       
  
 

 
   ......     .
  
Alig confidence 
















......




.


Template Conservation 

  
  

 

 


  


   


 



Template Sequence  FEITQHAKYGCPFCGKVAVKRAAVGIWKCKPC
Template Known Secondary structure  S

TTT

TTTTT
Template Predicted Secondary structure 













Template SS confidence 































   2930.........40.........50.........60
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D