Return to main results Retrieve Phyre Job Id

Job DescriptionQ9DB75
Confidence33.11%DateTue Jul 30 13:11:58 BST 2013
Rank28Aligned Residues30
% Identity10%Templatec3twkB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:formamidopyrimidine-dna glycosylase 1; PDBTitle: crystal structure of arabidopsis thaliana fpg
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   142.......150.........160.........170.........180.........190.........200.
Predicted Secondary structure 
















Query SS confidence 



























































Query Sequence  CPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYI
Query Conservation 

 
     
                            

       
  
 

 
    
Alig confidence 

















................................









Template Conservation 
  

  
      



................................  

 



 
Template Sequence  AFVDGKKIDFITAGGRTT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AYVPELQKLY
Template Predicted Secondary structure 







................................







Template SS confidence 



























































   252.......260......... 270.........
 
   202.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  CT
Query Conservation    
Alig confidence 

Template Conservation    
Template Sequence  GK
Template Predicted Secondary structure 
Template SS confidence 

   280.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D