Return to main results Retrieve Phyre Job Id

Job DescriptionQ9DB75
Confidence39.74%DateTue Jul 30 13:11:58 BST 2013
Rank15Aligned Residues26
% Identity46%Templatec2f5qA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:formamidopyrimidine-dna glycosidase; PDBTitle: catalytically inactive (e3q) mutm crosslinked to oxog:c2 containing dna cc2
Resolution2.35 Å
Model Dimensions (Å)X:35.549 Y:19.958 Z:14.384

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   142.......150.........160.........170.........180.........190.........
Predicted Secondary structure 
















Query SS confidence 

























































Query Sequence  CPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKA
Query Conservation 

 
     
                            

       
  
 

 
  
Alig confidence 














................................










Template Conservation 

 

  
     

................................
 
  

 


Template Sequence  CKRCGTPIEKTVVAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RGTHYCPRCQR
Template Known Secondary structure 
TTT

BBTT................................
TTT

Template Predicted Secondary structure 







................................





Template SS confidence 

























































   249250.........260... ......270....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D