Return to main results Retrieve Phyre Job Id

Job DescriptionP32020
Confidence99.88%DateTue Jul 30 13:21:56 BST 2013
Rank60Aligned Residues273
% Identity22%Templatec3ledA_
PDB info PDB header:transferaseChain: A: PDB Molecule:3-oxoacyl-acyl carrier protein synthase iii; PDBTitle: crystal structure of 3-oxoacyl-(acyl carrier protein) synthase iii2 from rhodopseudomonas palustris cga009
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30
Predicted Secondary structure 











......................................
Query SS confidence 





















. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Sequence  PRLRRVFVVGVGMTKFMKPGGE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation 
 



 




 


 
 
  ......................................
Alig confidence 












..






......................................
Template Conservation         
 
 
 ..  
    
 


                                 
Template Sequence  QGVRPAVIAATGL. . YTPPDSVSNAELVEAFNTYVANFNAANKARIEAGEIEPLQPSSSE
Template Known Secondary structure 




..

STTTSS






Template Predicted Secondary structure 



..






























Template SS confidence 



























































  
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D