Return to main results Retrieve Phyre Job Id

Job DescriptionP32020
Confidence22.32%DateTue Jul 30 13:21:56 BST 2013
Rank187Aligned Residues30
% Identity33%Templatec3ggpA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:prephenate dehydrogenase; PDBTitle: crystal structure of prephenate dehydrogenase from a. aeolicus in2 complex with hydroxyphenyl propionate and nad+
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50...
Predicted Secondary structure 




















Query SS confidence 














































Query Sequence  KSPRLRRVFVVGVGMTKFMKPGGENSRDYPDMAKEAGQKALEDAQIP
Query Conservation    
 



 




 


 
 
     
  


 

   

 



 
Alig confidence 














.................














Template Conservation    
 
  
 


 
 .................

  

  
   
  
Template Sequence  KSLSMQNVLIVGVGF. . . . . . . . . . . . . . . . . MGGSFAKSLRRSGFK
Template Known Secondary structure 





S
S.................TT

Template Predicted Secondary structure 








.................



Template SS confidence 














































   26...30.........40 .........50.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D