Return to main results Retrieve Phyre Job Id

Job DescriptionP32020
Confidence23.42%DateTue Jul 30 13:21:56 BST 2013
Rank186Aligned Residues42
% Identity14%Templatec2xznT_
PDB info PDB header:ribosomeChain: T: PDB Molecule:rps19e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 2
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   311........320.........330.........340.........350.........360.........370
Predicted Secondary structure 




























Query SS confidence 



























































Query Sequence  NELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCW
Query Conservation    
  





   


   
  
     
  


 


 

 


 




  
 
 
 
Alig confidence 













....................

























Template Conservation    




  
 


....................         

 

  
   

 

 
Template Sequence  WALKSLEDLKIIRK. . . . . . . . . . . . . . . . . . . . DKNSATKKFSRVITKEGMTELNRIAT
Template Known Secondary structure  TTS....................
SS
SSSTT

Template Predicted Secondary structure 


....................










Template SS confidence 



























































   106...110......... 120.........130.........140.....
 
   371.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  QL
Query Conservation 

Alig confidence 

Template Conservation   
Template Sequence  QI
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   146.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D