Return to main results Retrieve Phyre Job Id

Job DescriptionQ9ERV7
Confidence52.75%DateWed Jul 10 14:21:35 BST 2013
Rank156Aligned Residues49
% Identity8%Templatec3t76A_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator vanug; PDBTitle: crystal structure of transcriptional regulator vanug, form ii
Resolution1.12 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   795....800.........810.........820.........830.........840.........850....
Predicted Secondary structure 

















Query SS confidence 



























































Query Sequence  SNLLSVASRLGPDWPAVALHLGMPYHKLQRIRHEFRDDLDGQVRHMLFSWAERQTGQPGA
Query Conservation    
  

  

 

  

  
      
  
      
   
   

  
  
  
  

Alig confidence 































...................








Template Conservation   

  
  


 

  

   


  

  

................... 
   
   
Template Sequence  NKLWKLLIDRDXKKGELREAVGVSKSTFAKLG. . . . . . . . . . . . . . . . . . . KNENVSLTV
Template Known Secondary structure  TT

T

...................TT



Template Predicted Secondary structure 





...................





Template SS confidence 



























































   6...10.........20.........30....... ..40......
 
   855....860..
Predicted Secondary structure 
Query SS confidence 







Query Sequence  VGHLVQAL
Query Conservation     
  

Alig confidence 







Template Conservation 
  
   
Template Sequence  LLAICEYL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 







   47..50....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D