Return to main results Retrieve Phyre Job Id

Job DescriptionQ9ERV7
Confidence33.67%DateWed Jul 10 14:21:35 BST 2013
Rank172Aligned Residues26
% Identity31%Templatec2gzxB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:putative tatd related dnase; PDBTitle: crystal structure of the tatd deoxyribonuclease mw0446 from2 staphylococcus aureus. northeast structural genomics consortium3 target zr237.
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   804..... 810.........820.........
Predicted Secondary structure 


......................




Query SS confidence 





. . . . . . . . . . . . . . . . . . . . . .



















Query Sequence  LGPDWP. . . . . . . . . . . . . . . . . . . . . . AVALHLGMPYHKLQRIRHEF
Query Conservation 

 

 ...................... 

  
      
  
    
Alig confidence 





......................



















Template Conservation 



 
             
         
     

 
    
   
Template Sequence  VETDAPYLSPHPYRGKRNEPARVTLVAEQIAELKGLSYEEVCEQTTKN
Template Known Secondary structure 

BTTB


TTSTTS


GGGT

Template Predicted Secondary structure 



















Template SS confidence 















































   201........210.........220.........230.........240........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D