Return to main results Retrieve Phyre Job Id

Job DescriptionQ62077
Confidence99.24%DateTue Jul 30 13:20:18 BST 2013
Rank80Aligned Residues117
% Identity20%Templatec2fk9A_
PDB info PDB header:transferaseChain: A: PDB Molecule:protein kinase c, eta type; PDBTitle: human protein kinase c, eta
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1083..... .1090.........1100. ........1110.........1120......
Predicted Secondary structure 



.....

...........
















Query SS confidence 





. . . . .












. . . . . . . . . . .
























Query Sequence  RGLEPC. . . . . VICIEVLGARHLP. . . . . . . . . . . KNGRGIVCPFVEIEVAGAEYDSTKQ
Query Conservation        ..... 
 
 




 

...........
       






 
   
    
Alig confidence 





.....












...........














....





Template Conservation      
     
 
 
 
  
  
   
               



 
  ....      
Template Sequence  SGLVPTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSV. . . . DQVRVG
Template Known Secondary structure  S











TTTSSSS




....TT
Template Predicted Secondary structure 



































....





Template SS confidence 



























































  
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D