Return to main results Retrieve Phyre Job Id

Job DescriptionQ8CFU8
Confidence9.73%DateTue Jul 30 12:57:00 BST 2013
Rank27Aligned Residues20
% Identity30%Templatec1xk5A_
PDB info PDB header:transport proteinChain: A: PDB Molecule:snurportin-1; PDBTitle: crystal structure of the m3g-cap-binding domain of2 snurportin1 in complex with a m3gpppg-cap dinucleotide
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.......
Predicted Secondary structure 



































Query SS confidence 











































Query Sequence  GWLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDESWFVTPPA
Query Conservation   
 


                    
   
   



  



Alig confidence 

.






.......................










Template Conservation 

.
  

 
.......................
   
  



Template Sequence  EW. LIDVPSD. . . . . . . . . . . . . . . . . . . . . . . LGQEWIVVVCP
Template Known Secondary structure  .

S

TT.......................
Template Predicted Secondary structure  .



.......................






Template SS confidence 











































   106. ..110.... .....120.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D