Return to main results Retrieve Phyre Job Id

Job DescriptionQ8CFU8
Confidence3.52%DateTue Jul 30 12:57:00 BST 2013
Rank90Aligned Residues20
% Identity50%Templatec1k82D_
PDB info PDB header:hydrolase/dnaChain: D: PDB Molecule:formamidopyrimidine-dna glycosylase; PDBTitle: crystal structure of e.coli formamidopyrimidine-dna2 glycosylase (fpg) covalently trapped with dna
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70......
Predicted Secondary structure 




































Query SS confidence 












































Query Sequence  VDGWLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDESWFVTPP
Query Conservation   
 
 


                    
   
   



  


Alig confidence 









.........................









Template Conservation      
  


.........................
 
       
Template Sequence  PEGWIIIHLG. . . . . . . . . . . . . . . . . . . . . . . . . MSGSLRILPE
Template Known Secondary structure  SS

T.........................TT
SS
Template Predicted Secondary structure 


.........................





Template SS confidence 












































   63......70.. .......80..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D