Return to main results Retrieve Phyre Job Id

Job DescriptionA2A690
Confidence94.81%DateTue Jul 30 13:13:22 BST 2013
Rank187Aligned Residues117
% Identity16%Templatec3of5A_
PDB info PDB header:ligaseChain: A: PDB Molecule:dethiobiotin synthetase; PDBTitle: crystal structure of a dethiobiotin synthetase from francisella2 tularensis subsp. tularensis schu s4
Resolution1.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   360.........370 .........380.........390.........400.........410........
Predicted Secondary structure 






.



































Query SS confidence 










.















































Query Sequence  ASVNQGVVIVG. NIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPKHVDANRELPLTQ
Query Conservation            
.  
 


                                         
Alig confidence 










.














.................................
Template Conservation      
 
 


   







  

 .................................
Template Sequence  SNAXKKFFIIGTDTEVGKTYISTKLIE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure 
TT
SSSSS
.................................
Template Predicted Secondary structure 









.................................
Template SS confidence 



























































  
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D