Return to main results Retrieve Phyre Job Id

Job DescriptionA1L0T3
Confidence9.08%DateTue Jul 30 13:14:16 BST 2013
Rank16Aligned Residues28
% Identity25%Templatec2qg3B_
PDB info PDB header:unknown functionChain: B: PDB Molecule:upf0130 protein af_2059; PDBTitle: crystal structure of a tyw3 methyltransferase-like protein (af_2059)2 from archaeoglobus fulgidus dsm 4304 at 1.95 a resolution
Resolution1.95 Å
Model Dimensions (Å)X:27.956 Y:23.241 Z:28.162

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80...... ...90.........100..
Predicted Secondary structure 



........






Query SS confidence 











. . . . . . . .















Query Sequence  PSRCRGRLEVMH. . . . . . . . SGSWGSVCDDDWDVVD
Query Conservation       




  ........ 
 






 
    
Alig confidence 











........















Template Conservation 










       
     
   
      
Template Sequence  LSSCSGRIAVVDLEKPGDKASSLFLGKWHEGVEVSE
Template Known Secondary structure 

SSTT
GGG
SS


Template Predicted Secondary structure 



















Template SS confidence 



































   43......50.........60.........70........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D