Return to main results Retrieve Phyre Job Id

Job DescriptionQ8BGC0
Confidence87.85%DateTue Jul 30 13:06:17 BST 2013
Rank239Aligned Residues53
% Identity25%Templatec3ctrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:poly(a)-specific ribonuclease parn; PDBTitle: crystal structure of the rrm-domain of the poly(a)-specific2 ribonuclease parn bound to m7gtp
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   135....140.........150.........160.........170.........180.........190....
Predicted Secondary structure 

























Query SS confidence 



























































Query Sequence  NVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCYLKKES
Query Conservation   


  

 
 
  
    
   
 
           
   
  
  

   
 
   

Alig confidence 


























.........







......









Template Conservation 


  


  

  

  





 
 .........







......
 
 
     
Template Sequence  HVLHVTFPKEWKTSDLYQLFSAFGNIQ. . . . . . . . . ISWIDDTS. . . . . . AFVSLSQPEQ
Template Known Secondary structure 

TT

TTTS.........TT......
Template Predicted Secondary structure 











.........


......

Template SS confidence 



























































   446...450.........460.........470.. .......480 .........490
 
   195....200..
Predicted Secondary structure 
Query SS confidence 







Query Sequence  VELALKLL
Query Conservation     

  
Alig confidence 







Template Conservation 
  
    
Template Sequence  VKIAVNTS
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 







   491.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D