Return to main results Retrieve Phyre Job Id

Job DescriptionQ8BGC0
Confidence43.72%DateTue Jul 30 13:06:17 BST 2013
Rank243Aligned Residues22
% Identity23%Templatec3trzE_
PDB info PDB header:rna binding protein/rnaChain: E: PDB Molecule:protein lin-28 homolog a; PDBTitle: mouse lin28a in complex with let-7d microrna pre-element
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   153......160.........170.........180.........
Predicted Secondary structure 















Query SS confidence 




































Query Sequence  LMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCY
Query Conservation   
   
 
           
   
  
  

   
 
Alig confidence 





...........







....







Template Conservation       
........... 

 

  ....





  
Template Sequence  LLHGAG. . . . . . . . . . . ICKWFNVR. . . . MGFGFLSM
Template Known Secondary structure  S...........TT....TT
Template Predicted Secondary structure 


...........

....


Template SS confidence 




































   37..40.. .......50 ........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D