Return to main results Retrieve Phyre Job Id

Job DescriptionQ8BGC0
Confidence95.16%DateTue Jul 30 13:06:17 BST 2013
Rank235Aligned Residues47
% Identity19%Templatec3pq1A_
PDB info PDB header:transferaseChain: A: PDB Molecule:poly(a) rna polymerase; PDBTitle: crystal structure of human mitochondrial poly(a) polymerase (papd1)
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   134.....140.........150.........160.........170.........180.........190...
Predicted Secondary structure 


























Query SS confidence 



























































Query Sequence  TNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCYLKKE
Query Conservation 
 


  

 
 
  
    
   
 
           
   
  
  

   
 
   
Alig confidence 










....













........







....










Template Conservation   

 
      .... 
    
  
 
  ........       
....   



    
Template Sequence  RTVLIHCPEKN. . . . KFLKYLSQFGPINN. . . . . . . . HFFYESFG. . . . LYAVVEFCSIG
Template Known Secondary structure  T



....GGGS



........
SSS....



Template Predicted Secondary structure 



....


........




....


Template SS confidence 



























































   76...80...... ...90.........100 ........ .110.........
 
   194..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  SVE
Query Conservation 
  
Alig confidence 


Template Conservation     
Template Sequence  SLQ
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   126..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D