Return to main results Retrieve Phyre Job Id

Job DescriptionQ8K2K6
Confidence47.84%DateTue Jul 30 13:20:48 BST 2013
Rank39Aligned Residues42
% Identity19%Templated2je6b2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution1.6

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70. ........80.........90.........100.........110.........120..
Predicted Secondary structure 

.
















Query SS confidence 







.


















































Query Sequence  RVKSISMT. TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYE
Query Conservation   
 
    .             

                              
   
 
Alig confidence 







.





















.................











Template Conservation   
      
      
      
      
 .................   

 

    
Template Sequence  QVTLFQLNGSMTPDEFRQAFDLAVKGINIIY. . . . . . . . . . . . . . . . . NLEREALKSKYV
Template Known Secondary structure 




.................GGG
Template Predicted Secondary structure 





.................

Template SS confidence 



























































   199200.........210.........220......... 230.........240.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D