Return to main results Retrieve Phyre Job Id

Job DescriptionQ8K2K6
Confidence48.70%DateTue Jul 30 13:20:48 BST 2013
Rank38Aligned Residues45
% Identity18%Templated2br2b2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70. ........80.........90.........100.........110.........120..
Predicted Secondary structure 

.
















Query SS confidence 







.


















































Query Sequence  RVKSISMT. TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYE
Query Conservation   
 
    .             

                              
   
 
Alig confidence 







.





















.................











Template Conservation   
      
             
      
 .................   
  

    
Template Sequence  QVTLFQLNGSMTPDEFRQAFDLAVKGINIIY. . . . . . . . . . . . . . . . . NLEREALKSKYV
Template Known Secondary structure 




.................S

Template Predicted Secondary structure 





.................
Template SS confidence 



























































   199200.........210.........220......... 230.........240.
 
   123..
Predicted Secondary structure 

Query SS confidence 


Query Sequence  KKR
Query Conservation     
Alig confidence 


Template Conservation 
  
Template Sequence  EFK
Template Known Secondary structure 


Template Predicted Secondary structure 
Template SS confidence 


   242..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D