Return to main results Retrieve Phyre Job Id

Job DescriptionQ8K2K6
Confidence44.94%DateTue Jul 30 13:20:48 BST 2013
Rank46Aligned Residues49
% Identity14%Templated2ba0d2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution2.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70. ........80.........90.........100.........110......
Predicted Secondary structure 







.
















Query SS confidence 













.












































Query Sequence  GLNPPHRVKSISMT. TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEF
Query Conservation         
 
    .             

                              
Alig confidence 













.





















.................





Template Conservation         
      
    
    

  
   
  
 .................   
  
Template Sequence  RNGKIESIALLQMDGRMTRDEVKQAIELAKKGALQIY. . . . . . . . . . . . . . . . . EMQREA
Template Known Secondary structure  TT




.................
Template Predicted Secondary structure 









.................
Template SS confidence 



























































   194.....200.........210.........220.........230 ......
 
   117..120...
Predicted Secondary structure 
Query SS confidence 






Query Sequence  LQEKYEK
Query Conservation 
   
  
Alig confidence 






Template Conservation 
      
Template Sequence  ILRRYIE
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 






   237..240...
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D