Return to main results Retrieve Phyre Job Id

Job DescriptionQ8K2K6
Confidence37.80%DateTue Jul 30 13:20:48 BST 2013
Rank62Aligned Residues36
% Identity19%Templatec1yuzB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nigerythrin; PDBTitle: partially reduced state of nigerythrin
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.. .......30.........40.........50........
Predicted Secondary structure 
.















Query SS confidence 














.



































Query Sequence  KQEEKHLKMLRDMTG. LPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRG
Query Conservation              
  .   
  
  
                
  
   

 
Alig confidence 














.




...............















Template Conservation    
  
       
  
    ...............      
  

 
  
Template Sequence  LAESVHAERYLAAYNDIDAPD. . . . . . . . . . . . . . . DDKFHLCPICGYIHKG
Template Known Secondary structure  TTT


...............S


SSS

S
Template Predicted Secondary structure 


...............







Template SS confidence 



















































   147..150.........160....... ..170.........180...
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D