Return to main results Retrieve Phyre Job Id

Job DescriptionQ8BGA5
Confidence49.09%DateTue Jul 30 13:13:37 BST 2013
Rank56Aligned Residues27
% Identity22%Templatec1egaB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:protein (gtp-binding protein era); PDBTitle: crystal structure of a widely conserved gtpase era
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   158.160.........170.... .....180....
Predicted Secondary structure 



........

Query SS confidence 
















. . . . . . . .









Query Sequence  KRRQRLIGPKGSTLKAL. . . . . . . . ELLTNCYVMV
Query Conservation   

 



  
 
   
........
 

   
 
Alig confidence 
















........









Template Conservation 
 
 



  
  

 
   
   
       
 
Template Sequence  GQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHL
Template Known Secondary structure 
GGGSSSS
Template Predicted Secondary structure 









Template SS confidence 


































   241........250.........260.........270.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D