Return to main results Retrieve Phyre Job Id

Job DescriptionQ9QXE4
Confidence3.17%DateTue Jul 30 12:59:04 BST 2013
Rank69Aligned Residues30
% Identity23%Templatec1nstA_
PDB info PDB header:sulfotransferaseChain: A: PDB Molecule:heparan sulfate n-deacetylase/n-sulfotransferase; PDBTitle: the sulfotransferase domain of human haparin sulfate n-2 deacetylase/n-sulfotransferase
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   102...... .110.........120.........130.
Predicted Secondary structure 






.........











Query SS confidence 






. . . . . . . . .






















Query Sequence  PCFTAGG. . . . . . . . . LTTIKVETSPMENLLIEHPSMSV
Query Conservation 




 
.........  
   
















Alig confidence 






.........






















Template Conservation             
   


 





 
   
  

 
  
Template Sequence  PLWQDPCCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSS
Template Known Secondary structure 







TTS


TTSSTSTT
Template Predicted Secondary structure 

























Template SS confidence 






































   580.........590.........600.........610........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D