Return to main results Retrieve Phyre Job Id

Job DescriptionQ4QQM4
Confidence5.06%DateTue Jul 30 13:10:26 BST 2013
Rank73Aligned Residues26
% Identity38%Templatec2zuuA_
PDB info PDB header:transferaseChain: A: PDB Molecule:lacto-n-biose phosphorylase; PDBTitle: crystal structure of galacto-n-biose/lacto-n-biose i phosphorylase in2 complex with glcnac
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82...... .90.........100.........110.........120.........130
Predicted Secondary structure 

...








Query SS confidence 






. . .









































Query Sequence  ALPDQLY. . . DAVFDGAEVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIR
Query Conservation 


 
  ...
   
 

       

 
 

   


 
  
 
 

 


Alig confidence 






...




....................




...








Template Conservation 





 

 

  
....................
  

...  






Template Sequence  FFPDTFYEGNDPSIE. . . . . . . . . . . . . . . . . . . . GLDNW. . . RKARRAILR
Template Known Secondary structure  BSTTTSSTT

.......................TT
Template Predicted Secondary structure 













.......................
Template SS confidence 



















































   363......370....... ..380.. .......390.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D