Return to main results Retrieve Phyre Job Id

Job DescriptionQ5SQX6
Confidence5.74%DateWed Jul 10 14:11:20 BST 2013
Rank96Aligned Residues41
% Identity24%Templatec2lsjA_
PDB info PDB header:protein binding/protein bindingChain: A: PDB Molecule:dna repair protein rev1; PDBTitle: solution structure of the mouse rev1 ctd in complex with the rev1-2 interacting region (rir)of pol kappa
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   510.........520.........530.........540.........550.........560.........
Predicted Secondary structure 




































Query SS confidence 



























































Query Sequence  LQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQLYMVRTMLESLI
Query Conservation 
  

 
  

  
 
   
      

           
 
 

  

  


 
  

Alig confidence 
















..........................
















Template Conservation 
 


  
  
  
   ..........................
   

  
  

  

Template Sequence  FSDVKTLLKEWITTISD. . . . . . . . . . . . . . . . . . . . . . . . . . PMEEDILQVVRYCTDLI
Template Known Secondary structure  T
SS..........................

Template Predicted Secondary structure 


..........................

Template SS confidence 



























































   33......40......... 50.........60......
 
   570......
Predicted Secondary structure 






Query SS confidence 






Query Sequence  ADKSGSK
Query Conservation     
  
Alig confidence 






Template Conservation    
 


Template Sequence  EEKDLEK
Template Known Secondary structure  T
Template Predicted Secondary structure 


Template SS confidence 






   67..70...
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D