Return to main results Retrieve Phyre Job Id

Job DescriptionQ5SQX6
Confidence7.54%DateWed Jul 10 14:11:20 BST 2013
Rank60Aligned Residues23
% Identity43%Templatec2dw3A_
PDB info PDB header:photosynthesisChain: A: PDB Molecule:intrinsic membrane protein pufx; PDBTitle: solution structure of the rhodobacter sphaeroides pufx2 membrane protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1128.1130.........1140.........1150.........1160.......
Predicted Secondary structure 









Query SS confidence 







































Query Sequence  RLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLL
Query Conservation 








 
 
         
 




 



 

 

Alig confidence 








.................













Template Conservation 








.................













Template Sequence  RLWVAFQMM. . . . . . . . . . . . . . . . . KGAGWAGGVFFGTL
Template Known Secondary structure  .................
Template Predicted Secondary structure  .................



Template SS confidence 







































   1920....... ..30.........40.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D