Return to main results Retrieve Phyre Job Id

Job DescriptionP39023
Confidence3.58%DateThu Apr 26 09:26:30 BST 2012
Rank98Aligned Residues27
% Identity15%Templatec3hqxA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:upf0345 protein aciad0356; PDBTitle: crystal structure of protein of unknown function (duf1255,pf06865)2 from acinetobacter sp. adp1
Resolution1.66 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   181........190.........200.........210.........220....
Predicted Secondary structure 












Query SS confidence 











































Query Sequence  MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTK
Query Conservation   

 
 

 
 



 
   




 
 


  
  


 
 

Alig confidence 








.....

............















Template Conservation    


 
  .....

............    

 

 




 
Template Sequence  CRVKIADST. . . . . ES. . . . . . . . . . . . ELFRAGQSFYVPGNSL
Template Known Secondary structure  TT
S.....S
............TT

TT
Template Predicted Secondary structure 



.....

............







Template SS confidence 











































   65....70... .. ....80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions