Return to main results Retrieve Phyre Job Id

Job DescriptionP04637
Confidence6.88%DateFri May 25 09:44:00 BST 2012
Rank69Aligned Residues20
% Identity40%Templatec3lsoA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:putative membrane anchored protein; PDBTitle: crystal structure of putative membrane anchored protein from2 corynebacterium diphtheriae
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   104.....110.........120.........130...
Predicted Secondary structure 
















Query SS confidence 





























Query Sequence  QGSYGFRLGFLHSGTAKSVTCTYSPALNKM
Query Conservation 

   
 
 
      

  



  



Alig confidence 









..........









Template Conservation            ..........          
Template Sequence  PGIYXFQXGV. . . . . . . . . . YKYSNSLKDL
Template Known Secondary structure  S..........TTTT
Template Predicted Secondary structure 



..........

Template SS confidence 





























   444.....450... ......460...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions