Return to main results Retrieve Phyre Job Id

Job DescriptionQ9Y6P5
Confidence10.06%DateWed Jun 6 09:39:41 BST 2012
Rank32Aligned Residues39
% Identity18%Templatec3f4mA_
PDB info PDB header:immune systemChain: A: PDB Molecule:tumor necrosis factor, alpha-induced protein 8- PDBTitle: crystal structure of tipe2
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   77..80.........90.........100.........110.........120.........
Predicted Secondary structure 












Query SS confidence 




















































Query Sequence  ALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQ
Query Conservation    


  
  

  

 

  
  
   

  




   











 
Alig confidence 












.










.............














Template Conservation 
  

  

 

 .  


  

  .............     
  

  

 
Template Sequence  SHGRIRHVFDHFS. DPGLLTALYGP. . . . . . . . . . . . . DFTQHLGKICDGLRK
Template Known Secondary structure  T.
TSG.............GG
Template Predicted Secondary structure 
.


.............
Template SS confidence 




















































   139140.........150. ........160.. .......170.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions