Return to main results Retrieve Phyre Job Id

Job DescriptionQ9Y6P5
Confidence7.64%DateWed Jun 6 09:39:41 BST 2012
Rank51Aligned Residues38
% Identity24%Templatec3eq5G_
PDB info PDB header:signaling proteinChain: G: PDB Molecule:ski-like protein; PDBTitle: crystal structure of fragment 137 to 238 of the human ski-like protein
Resolution2.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   419420.........430.........440...... ...450.........
Predicted Secondary structure 






...................

Query SS confidence 



























. . . . . . . . . . . . . . . . . . .












Query Sequence  DYDYGEINQLLDRSFKVYIKTVVCTPEK. . . . . . . . . . . . . . . . . . . VTKRMYDSFWRQF
Query Conservation 



 





 
 

 


 
 
 


...................

  

      
Alig confidence 











...












...................












Template Conservation    
   
     ... 
 
    

 


  

  
 

  
  
 


  




  
 
Template Sequence  EFTLQQINTVCD. . . ELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNAL
Template Known Secondary structure  TS
...TT




TTSS
TT



Template Predicted Secondary structure 


...



















Template SS confidence 



























































   177..180........ .190.........200.........210.........220.........230...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions