Return to main results Retrieve Phyre Job Id

Job DescriptionQ9Y6P5
Confidence5.74%DateWed Jun 6 09:39:41 BST 2012
Rank80Aligned Residues24
% Identity25%Templatec2krcA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:dna-directed rna polymerase subunit delta; PDBTitle: solution structure of the n-terminal domain of bacillus2 subtilis delta subunit of rna polymerase
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   403......410.........420. .....
Predicted Secondary structure 








......
Query SS confidence 


















. . . . . .




Query Sequence  RAIWNYIHCMFGIRYDDYD. . . . . . YGEIN
Query Conservation 







 
 

 




......
 


Alig confidence 


















......




Template Conservation   

  

              


 




Template Sequence  QELLNEIASLLGVKKEELGDRIAQFYTDLN
Template Known Secondary structure  TS
GGGGT
Template Predicted Secondary structure 


Template SS confidence 





























   34.....40.........50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions