Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence38.78%DateWed May 9 18:00:30 BST 2012
Rank78Aligned Residues35
% Identity20%Templated2nn6d2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution3.35

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   90.........100.........110.........120.........130.........140.
Predicted Secondary structure 
















Query SS confidence 



















































Query Sequence  TFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEK
Query Conservation    
 


      

  
               
          


 

  
Alig confidence 





















.................












Template Conservation        
      
      
 .................   
  
 
  

Template Sequence  LYSDTELQQCLAAAQAASQHVF. . . . . . . . . . . . . . . . . RFYRESLQRRYSK
Template Known Secondary structure  S

.................T

Template Predicted Secondary structure 


.................

Template SS confidence 



















































   200.........210.........220. ........230....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions