Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence74.95%DateWed May 9 18:00:30 BST 2012
Rank25Aligned Residues41
% Identity20%Templated2je6b2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution1.6

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82....... 90.........100.........110.........120.........130.........
Predicted Secondary structure 

.
















Query SS confidence 







.

















































Query Sequence  RVKSISMT. TFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKY
Query Conservation 







.  
 


      

  
               
          


 

Alig confidence 







.





















.................










Template Conservation   
      
      
      
      
 .................   

 

   
Template Sequence  QVTLFQLNGSMTPDEFRQAFDLAVKGINIIY. . . . . . . . . . . . . . . . . NLEREALKSKY
Template Known Secondary structure 




.................GGG
Template Predicted Secondary structure 





.................
Template SS confidence 


























































   199200.........210.........220......... 230.........240
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions