Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence21.81%DateWed May 9 18:00:30 BST 2012
Rank164Aligned Residues30
% Identity17%Templated1irqa_
SCOP infoRibbon-helix-helix Ribbon-helix-helix Omega transcriptional repressor
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.........110.........120.........130.........140...
Predicted Secondary structure 













Query SS confidence 















































Query Sequence  VVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKR
Query Conservation 
      

  
               
          


 

  
 
Alig confidence 










..


................















Template Conservation 










..


................   
       




Template Sequence  IETAKNGGNVK. . EVM. . . . . . . . . . . . . . . . DQALEEYIRKYLPDKL
Template Known Secondary structure  T

..................STT

Template Predicted Secondary structure 





..................




Template SS confidence 















































   42.......50.. ... ....60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions