Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence78.43%DateWed May 9 18:00:30 BST 2012
Rank19Aligned Residues35
% Identity29%Templated1cjya2
SCOP infoFabD/lysophospholipase-like FabD/lysophospholipase-like Lysophospholipase
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   90.........100. .. ......110.........120.........130.........140...
Predicted Secondary structure 


..













Query SS confidence 











.

.







































Query Sequence  TFTEPEVVFLQS. RG. NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKR
Query Conservation    
 


     . 
.
  
               
          


 

  
 
Alig confidence 











.

.


...................

















Template Conservation   

 
  
 
  
   

 ................... 
   
   

 
  


Template Sequence  QYPNQAFKRLHDLMHFNTL. . . . . . . . . . . . . . . . . . . NNIDVIKEAMVESIEYRR
Template Known Secondary structure 


...................TTS
Template Predicted Secondary structure 


...................
Template SS confidence 























































   684.....690.........700.. .......710.........720
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions