Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence25.55%DateWed May 9 18:00:30 BST 2012
Rank136Aligned Residues30
% Identity23%Templatec2yfvC_
PDB info PDB header:cell cycleChain: C: PDB Molecule:scm3; PDBTitle: the heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Resolution2.32 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   90.........100.........110.........120.........130.........140
Predicted Secondary structure 
















Query SS confidence 


















































Query Sequence  TFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYE
Query Conservation    
 


      

  
               
          


 

 
Alig confidence 





















.....................







Template Conservation 







 


 





 

.....................  

 


Template Sequence  KLSDEEVMERHKKADENMKRVW. . . . . . . . . . . . . . . . . . . . . SQIIQKYE
Template Known Secondary structure 


.....................
Template Predicted Secondary structure 


.....................
Template SS confidence 


















































   57..60.........70........ .80......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions