Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence20.68%DateWed May 9 18:00:30 BST 2012
Rank178Aligned Residues35
% Identity11%Templatec2wa1A_
PDB info PDB header:transferaseChain: A: PDB Molecule:non-structural protein 5; PDBTitle: structure of the methyltransferase domain from modoc virus,2 a flavivirus with no known vector (nkv)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.......
Predicted Secondary structure 



























Query SS confidence 


















































Query Sequence  GGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVC
Query Conservation                            

  
 

    
 
 
 
 
 


Alig confidence 



















..........









......




Template Conservation 
 
  
   
 

   

 
..........
   
   

......
 

 
Template Sequence  GESNPTAAVEASRTLTVLNV. . . . . . . . . . ISRWLEYNQG. . . . . . CGFCV
Template Known Secondary structure 



SS..........STT......
Template Predicted Secondary structure 





..........


......
Template SS confidence 


















































   149150.........160........ .170........ .180...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions